PDB entry 2rmn

View 2rmn on RCSB PDB site
Description: the solution structure of the p63 dna-binding domain
Deposited on 2007-11-01, released 2008-11-11
The last revision was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Gene: p63
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3D4 (1-232)
      • expression tag (0)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rmnA (A:)
gsstfdalspspaipsntdypgphsfdvsfqqsstaksatwtystelkklycqiaktcpi
qikvmtpppqgavirampvykkaehvtevvkrcpnhelsrefnegqiappshlirvegns
haqyvedpitgrqsvlvpyeppqvgtefttvlynfmcnsscvggmnrrpiliivtletrd
gqvlgrrcfearicacpgrdrkadedsirkqqvsdstkngdafrqnthgiqmt