PDB entry 2rml

View 2rml on RCSB PDB site
Description: Solution structure of the N-terminal soluble domains of Bacillus subtilis CopA
Class: hydrolase
Keywords: CopA, P-type ATPase, ATP-binding, Copper, Copper transport, Hydrolase, Ion transport, Magnesium, Membrane, Metal-binding, Nucleotide-binding, Phosphorylation, Transmembrane, Transport
Deposited on 2007-10-30, released 2008-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting P-type ATPase copA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CopA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rmla1, d2rmla2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rmlA (A:)
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetsnviydpaetgtaai
qekieklgyhvvtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynp
keasvsdlkeavdklgyklklkgeqds