PDB entry 2rmj

View 2rmj on RCSB PDB site
Description: Solution structure of RIG-I C-terminal domain
Class: Hydrolase
Keywords: RNA binding protein, Alternative splicing, Antiviral defense, ATP-binding, Cytoplasm, Helicase, Hydrolase, Immune response, Innate immunity, Interferon induction, Nucleotide-binding, Polymorphism, RNA-binding, Ubl conjugation
Deposited on 2007-10-23, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX58
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rmja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmjA (A:)
    dsqekpkpvpdkenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpk
    qfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdf
    hfekipfdpaemsk