PDB entry 2rme

View 2rme on RCSB PDB site
Description: Stressin
Class: neuropeptide
Keywords: NMR, CRF ligand, Sauvagine, Astressin2B, Urocortins, Urotensins, CRF receptors, NEUROPEPTIDE
Deposited on 2007-10-16, released 2008-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stressin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2RME (0-37)
    Domains in SCOPe 2.07: d2rmea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmeA (A:)
    ppisldltfhllrevlelaraeqlaqqehskrklleii