PDB entry 2rmb

View 2rmb on RCSB PDB site
Description: Crystal structures of cyclophilin A complexed with cyclosporin A and N-methyl-4-[(E)-2-butenyl]-4,4-dimethylthreonine cyclosporin A
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 1994-01-07, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmba_
  • Chain 'B':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'C':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbc_
  • Chain 'D':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'E':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbe_
  • Chain 'F':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'G':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbg_
  • Chain 'H':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'I':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbi_
  • Chain 'J':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'K':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbk_
  • Chain 'L':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'M':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbm_
  • Chain 'N':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'O':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbo_
  • Chain 'P':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'Q':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbq_
  • Chain 'R':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Chain 'S':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rmbs_
  • Chain 'T':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbC (C:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbE (E:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbG (G:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbI (I:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbK (K:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbM (M:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbO (O:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbQ (Q:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rmbS (S:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'T':
    No sequence available.