PDB entry 2rlz

View 2rlz on RCSB PDB site
Description: Solid-State MAS NMR structure of the dimer Crh
Class: transport protein
Keywords: domain-swap, dimer, MAS, solid-state NMR, Phosphorylation, TRANSPORT PROTEIN
Deposited on 2007-09-04, released 2008-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HPr-like protein crh
  Species: Bacillus subtilis
  Gene: crh, yvcM
  Database cross-references and differences (RAF-indexed):
  • Uniprot O06976 (0-84)
  Domains in SCOPe 2.08: d2rlza1
• Chain 'B':
  Compound: HPr-like protein crh
  Species: Bacillus subtilis
  Gene: crh, yvcM
  Database cross-references and differences (RAF-indexed):
  • Uniprot O06976 (0-84)
  Domains in SCOPe 2.08: d2rlzb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rlzA (A:)
  mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
  vtliaqgedeqealeklaayvqeev
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rlzB (B:)
  mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
  vtliaqgedeqealeklaayvqeev