PDB entry 2rlt

View 2rlt on RCSB PDB site
Description: phosphorylated CPI-17 (22-120)
Class: hydrolase
Keywords: phosphorylation, PP1 inhibitor, Cytoplasm, Protein phosphatase inhibitor, HYDROLASE
Deposited on 2007-08-11, released 2008-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phosphatase 1 regulatory subunit 14A
    Species: Sus scrofa [TaxId:9823]
    Gene: CPI17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rlta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rltA (A:)
gpggspgglqkrharvtvkydrrelqrrldvekwidgrleelyrgreadmpdevnidell
eleseeersrkiqgllksctnptenfvqellvklrglhk