PDB entry 2rln

View 2rln on RCSB PDB site
Description: thermodynamic and structural consequences of changing a sulphur atom to a methylene group in the m13nle mutation in ribonuclease s
Deposited on 1994-07-11, released 1994-11-01
The last revision prior to the SCOP 1.57 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.57: d2rln.1
  • Chain 'S':
    Domains in SCOP 1.57: d2rln.1

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rlnE (E:)
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rlnS (S:)
ketaaakferqhlds