PDB entry 2rln

View 2rln on RCSB PDB site
Description: thermodynamic and structural consequences of changing a sulphur atom to a methylene group in the m13nle mutation in ribonuclease s
Class: hydrolase(phosphoric diester,RNA)
Keywords: hydrolase(phosphoric diester, RNA)
Deposited on 1994-07-11, released 1994-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: ribonuclease s (s-protein)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rln.1
  • Chain 'S':
    Compound: Ribonuclease
    Database cross-references and differences (RAF-indexed):
    • PDB 2RLN (0-End)
    Domains in SCOPe 2.08: d2rln.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >2rlnE (E:)
stsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqs
ystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

    Sequence, based on observed residues (ATOM records): (download) 
    >2rlnE (E:)
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rlnS (S:)
ketaaakferqhlds