PDB entry 2rlf

View 2rlf on RCSB PDB site
Description: Proton Channel M2 from Influenza A in complex with inhibitor rimantadine
Class: proton transport
Keywords: m2, proton channel, rimantadine, PROTON TRANSPORT
Deposited on 2007-07-11, released 2008-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Matrix protein 2
  Species: Influenza A virus (A/Udorn/307/1972(H3N2)) [TaxId:381517]
  Gene: M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63231 (Start-42)
    • engineered (32)
  Domains in SCOPe 2.08: d2rlfa1
• Chain 'B':
  Compound: Matrix protein 2
  Species: Influenza A virus (A/Udorn/307/1972(H3N2)) [TaxId:381517]
  Gene: M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63231 (Start-42)
    • engineered (32)
• Chain 'C':
  Compound: Matrix protein 2
  Species: Influenza A virus (A/Udorn/307/1972(H3N2)) [TaxId:381517]
  Gene: M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63231 (Start-42)
    • engineered (32)
• Chain 'D':
  Compound: Matrix protein 2
  Species: Influenza A virus (A/Udorn/307/1972(H3N2)) [TaxId:381517]
  Gene: M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63231 (Start-42)
    • engineered (32)
• Heterogens: RIM

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2rlfA (A:)
  rsndssdplvvaasiigilhlilwildrlffksiyrffehglk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2rlfA (A:)
  sdplvvaasiigilhlilwildrlffksiyrffehglk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.