PDB entry 2rlc

View 2rlc on RCSB PDB site
Description: Crystal Structure of the Conjugated Bile Acid Hydrolase from Clostridium perfringens in Complex with Reaction Products Glycine and Cholate
Class: hydrolase
Keywords: Choloylglycine hydrolase, BSH, Ntn-hydrolase
Deposited on 2007-10-18, released 2009-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-17, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choloylglycine hydrolase
    Species: Clostridium perfringens [TaxId:1502]
    Gene: cbh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rlca_
  • Heterogens: SO4, CHD, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rlcA (A:)
    ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
    ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
    alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
    hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
    ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
    idmnkenldgneiktykynktlsinhvn