PDB entry 2rl0

View 2rl0 on RCSB PDB site
Description: Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
Class: cell adhesion
Keywords: FIBRONECTIN, 4F15F1, BETA ZIPPER, STAPHYLOCOCCUS AUREUS, Acute phase, Alternative splicing, Cell adhesion, Extracellular matrix, Glycoprotein, Heparin-binding, Phosphorylation, Pyrrolidone carboxylic acid, Secreted, Sulfation, Cell wall, Peptidoglycan-anchor, Virulence
Deposited on 2007-10-18, released 2008-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-88)
  Domains in SCOPe 2.08: d2rl0a1, d2rl0a2
• Chain 'B':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-88)
  Domains in SCOPe 2.08: d2rl0b1, d2rl0b2
• Chain 'C':
  Compound: Fibronectin-binding protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738 (Start-17)
• Chain 'D':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-88)
  Domains in SCOPe 2.08: d2rl0d1, d2rl0d2
• Chain 'E':
  Compound: Fibronectin-binding protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738
• Chain 'F':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-88)
  Domains in SCOPe 2.08: d2rl0f1, d2rl0f2
• Chain 'G':
  Compound: Fibronectin-binding protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738 (0-End)
• Chain 'H':
  Compound: Fibronectin-binding protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738 (Start-17)
• Chain 'I':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-End)
  Domains in SCOPe 2.08: d2rl0i1, d2rl0i2
• Chain 'J':
  Compound: Fibronectin-binding protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738
• Chain 'K':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-88)
  Domains in SCOPe 2.08: d2rl0k1, d2rl0k2
• Chain 'L':
  Compound: Fibronectin-binding protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738 (Start-17)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rl0A (A:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwskkdnrgnllqcictgngrgewkcer
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rl0B (B:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwskkdnrgnllqcictgngrgewkcer
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rl0D (D:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwskkdnrgnllqcictgngrgewkcer
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >2rl0F (F:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwskkdnrgnllqcictgngrgewkcer
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2rl0F (F:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwskkdrgnllqcictgngrgewkcer
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  Sequence, based on SEQRES records: (download)
  

  >2rl0I (I:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwskkdnrgnllqcictgngrgewkcer
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2rl0I (I:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwsqcictgngrgewkce
  

  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rl0K (K:)
  ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyrig
  dtwskkdnrgnllqcictgngrgewkcer
  

  
  
• Chain 'L':
  No sequence available.