PDB entry 2rku

View 2rku on RCSB PDB site
Description: Structure of PLK1 in complex with BI2536
Class: transferase
Keywords: Structure of PLK1, selectivity residues, kinase, polo-like kinase, structure based drug design, ATP-binding, Nucleotide-binding, Nucleus, Phosphorylation, Serine/threonine-protein kinase, Transferase
Deposited on 2007-10-17, released 2008-02-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Serine/threonine-protein kinase PLK1
  Species: Homo sapiens [TaxId:9606]
  Gene: PLK1, PLK
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53350 (0-293)
    • engineered (173)
  Domains in SCOPe 2.05: d2rkua_
• Heterogens: ZN, R78, TLA, SRT, TAR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rkuA (A:)
  akeipevlvdprsrrryvrgrflgkggfakcfeisdadtkevfagkivpkslllkphqre
  kmsmeisihrslahqhvvgfhgffedndfvfvvlelcrrrsllelhkrrkaltepearyy
  lrqivlgcqylhrnrvihrdlklgnlflnedlevkigdfglatkveydgerkkvlcgtpn
  yiapevlskkghsfevdvwsigcimytllvgkppfetsclketylrikkneysipkhinp
  vaasliqkmlqtdptarptinellndefftsgyiparlpitcltipprfsiaps