PDB entry 2rku

View 2rku on RCSB PDB site
Description: Structure of PLK1 in complex with BI2536
Class: transferase
Keywords: Structure of PLK1, selectivity residues, kinase, polo-like kinase, structure based drug design, ATP-binding, Nucleotide-binding, Nucleus, Phosphorylation, Serine/threonine-protein kinase, Transferase
Deposited on 2007-10-17, released 2008-02-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53350 (0-293)
      • engineered (173)
    Domains in SCOPe 2.03: d2rkua_
  • Heterogens: ZN, R78, TLA, SRT, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rkuA (A:)
    akeipevlvdprsrrryvrgrflgkggfakcfeisdadtkevfagkivpkslllkphqre
    kmsmeisihrslahqhvvgfhgffedndfvfvvlelcrrrsllelhkrrkaltepearyy
    lrqivlgcqylhrnrvihrdlklgnlflnedlevkigdfglatkveydgerkkvlcgtpn
    yiapevlskkghsfevdvwsigcimytllvgkppfetsclketylrikkneysipkhinp
    vaasliqkmlqtdptarptinellndefftsgyiparlpitcltipprfsiaps