PDB entry 2rks

View 2rks on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant PHS L38K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, internal ion pair
Deposited on 2007-10-17, released 2008-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (37)
      • engineered (116)
      • engineered (123)
      • engineered (127)
    Domains in SCOPe 2.08: d2rksa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rksA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrllkvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    heqllrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rksA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrllkvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniws