PDB entry 2rkq

View 2rkq on RCSB PDB site
Description: Crystal structure of drosophila peptidoglycan recognition protein SD (PGRP-SD)
Class: immune system
Keywords: innate immunity; Toll; pattern recognition; PGRP; Drosophila, Glycoprotein, Immune response, Secreted,, IMMUNE SYSTEM
Deposited on 2007-10-17, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan-recognition protein-SD
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PGRP-SD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VS97 (0-167)
      • see remark 999 (22)
      • see remark 999 (49)
      • expression tag (168)
    Domains in SCOPe 2.08: d2rkqa1, d2rkqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rkqA (A:)
    evpivtraewnakppngaidsmvtplpraviahtaggacaddvtcsqhmrnlqnfqmskq
    kfsdigyhyliggngkvyegrspsqrgafagpnndgslgiafignfeerapnkealdaak
    elleqavkqaqlvegykllghrqvsatkspgealyaliqqwpnwseeml