PDB entry 2rkn

View 2rkn on RCSB PDB site
Description: X-ray structure of the self-defense and signaling protein DIR1 from Arabidopsis taliana
Deposited on 2007-10-17, released 2008-09-02
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DIR1 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DIR1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, LP3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2rknA (A:)
aidlcgmsqdelneckpavskenptspsqpcctalqhadfaclcgyknspwlgsfgvdpe
lasalpkqcglanaptc