PDB entry 2rk2

View 2rk2 on RCSB PDB site
Description: DHFR R-67 complexed with NADP
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, NADP, asymmetric ligand binding, Antibiotic resistance, Methotrexate resistance, One-carbon metabolism, Trimethoprim resistance
Deposited on 2007-10-16, released 2008-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.144
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrofolate reductase type 2
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rk2a_
  • Heterogens: NAP, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rk2A (A:)
    vfpsnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
    in
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rk2A (A:)
    natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin