PDB entry 2rk1

View 2rk1 on RCSB PDB site
Description: DHFR R67 Complexed with NADP and dihydrofolate
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, NADP, dihydrofolate, asymmetric ligand binding, Antibiotic resistance, Methotrexate resistance, One-carbon metabolism, Plasmid, Trimethoprim resistance
Deposited on 2007-10-16, released 2008-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.124
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrofolate reductase type 2
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rk1a_
  • Heterogens: DHF, NAP, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rk1A (A:)
    vfpsnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
    in
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rk1A (A:)
    natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin