PDB entry 2rjy

View 2rjy on RCSB PDB site
Description: Crystal structure of villin headpiece, P21 21 21 space group
Class: structural protein
Keywords: HELIX, Actin capping, Actin-binding, Calcium, Cytoplasm, Cytoskeleton, STRUCTURAL PROTEIN
Deposited on 2007-10-16, released 2008-09-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.209
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Villin-1
    Species: GALLUS GALLUS
    Gene: VIL1, VIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2rjya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rjyA (A:)
    ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnl
    kkekglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rjyA (A:)
    letfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnlkke
    kglf