PDB entry 2rjw

View 2rjw on RCSB PDB site
Description: The crystal structure of the H41Y mutant of villin headpiece, P61 SPACE GROUP.
Class: structural protein
Keywords: HELIX, Actin capping, Actin-binding, Calcium, Cytoplasm, Cytoskeleton, STRUCTURAL PROTEIN
Deposited on 2007-10-16, released 2009-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.202
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Villin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: VIL1, VIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02640 (0-66)
      • engineered (31)
    Domains in SCOPe 2.08: d2rjwa_
  • Chain 'B':
    Compound: Villin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: VIL1, VIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02640 (0-66)
      • engineered (31)
    Domains in SCOPe 2.08: d2rjwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rjwA (A:)
    ptkletfpldvlvntaaedlprgvdpsrkenylsdedfkavfgmtrsafanlplwkqqnl
    kkekglf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rjwB (B:)
    ptkletfpldvlvntaaedlprgvdpsrkenylsdedfkavfgmtrsafanlplwkqqnl
    kkekglf