PDB entry 2rjv

View 2rjv on RCSB PDB site
Description: Crystal structure of the H41Y mutant of villin headpiece, P 21 21 21 space group
Class: structural protein
Keywords: HELIX, Actin capping, Actin-binding, Calcium, Cytoplasm, Cytoskeleton, STRUCTURAL PROTEIN
Deposited on 2007-10-15, released 2008-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.18
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Villin-1
  Species: GALLUS GALLUS
  Gene: VIL1, VIL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02640 (0-66)
    • engineered (31)
  Domains in SCOPe 2.08: d2rjva_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rjvA (A:)
  ptkletfpldvlvntaaedlprgvdpsrkenylsdedfkavfgmtrsafanlplwkqqnl
  kkekglf