PDB entry 2rjt

View 2rjt on RCSB PDB site
Description: Crystal Structure Analysis of a Surface Entropy Reduction Mutant of S. pneumoniae FabF
Class: transferase
Keywords: KASII, beta-ketoacyl acyl carrier protein synthase, thiolase, FabF, Acyltransferase, Transferase
Deposited on 2007-10-15, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-ketoacyl-ACP synthase II
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: fabF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBC2 (Start-427)
      • engineered (40)
      • engineered (112)
      • engineered (343)
      • engineered (401)
      • engineered (427)
    Domains in SCOPe 2.07: d2rjta1, d2rjta2
  • Chain 'B':
    Compound: Beta-ketoacyl-ACP synthase II
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: fabF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBC2 (Start-427)
      • engineered (40)
      • engineered (112)
      • engineered (343)
      • engineered (401)
      • engineered (427)
    Domains in SCOPe 2.07: d2rjtb1, d2rjtb2
  • Chain 'C':
    Compound: Beta-ketoacyl-ACP synthase II
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: fabF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBC2 (Start-427)
      • engineered (40)
      • engineered (112)
      • engineered (343)
      • engineered (401)
      • engineered (427)
    Domains in SCOPe 2.07: d2rjtc1, d2rjtc2
  • Chain 'D':
    Compound: Beta-ketoacyl-ACP synthase II
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: fabF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBC2 (Start-427)
      • engineered (40)
      • engineered (112)
      • engineered (343)
      • engineered (401)
      • engineered (427)
    Domains in SCOPe 2.07: d2rjtd1, d2rjtd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rjtA (A:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpaefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkavpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglakeipyaisntfgfgghna
    vlafkrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rjtA (A:)
    klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkavpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglakeipyaisntfgfgghnavlafkrwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rjtB (B:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpaefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkavpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglakeipyaisntfgfgghna
    vlafkrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rjtB (B:)
    klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkavpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglakeipyaisntfgfgghnavlafkrwa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rjtC (C:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpaefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkavpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglakeipyaisntfgfgghna
    vlafkrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rjtC (C:)
    klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkavpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglakeipyaisntfgfgghnavlafkrwa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rjtD (D:)
    gsshhhhhhssglvprgshmklnrvvvtgygvtspigntpaefwnslatgkigiggitkf
    dhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrf
    gvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksin
    tacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasip
    fdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgaik
    aiklaleeaeispeqvayvnahgtstpanekgesgaivavlgkavpvsstksftghllga
    agaveaivtieamrhnfvpmtagtsevsdyieanvvygqglakeipyaisntfgfgghna
    vlafkrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rjtD (D:)
    klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
    yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr
    lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
    fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
    slehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvn
    ahgtstpanekgesgaivavlgkavpvsstksftghllgaagaveaivtieamrhnfvpm
    tagtsevsdyieanvvygqglakeipyaisntfgfgghnavlafkrwa