PDB entry 2rj2

View 2rj2 on RCSB PDB site
Description: Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
Class: ligase
Keywords: UBIQUITIN, SCF, UBIQUITIN LIGASE, LECTIN, Ubl conjugation pathway
Deposited on 2007-10-14, released 2008-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: F-box only protein 2
  Species: Mus musculus [TaxId:10090]
  Gene: Fbxo2, Fbx2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q80UW2 (4-184)
    • leader sequence (0-3)
    • see remark 999 (38)
    • see remark 999 (46-47)
  Domains in SCOPe 2.08: d2rj2a1, d2rj2a2
• Heterogens: NI, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rj2A (A:)
  gshmfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdgnveftqddsvkky
  fassfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsene
  dvlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnss
  vwvep