PDB entry 2rix

View 2rix on RCSB PDB site
Description: B-specific-1,3-galactosyltransferase)(GTB) + UDP
Class: transferase
Keywords: GTB ABO Rossman fold BBBB unliganded, Blood group antigen, Glycoprotein, Glycosyltransferase, Golgi apparatus, Manganese, Membrane, Metal-binding, Secreted, Signal-anchor, Transferase, Transmembrane
Deposited on 2007-10-13, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (2-End)
      • expression tag (0-1)
      • see remark 999 (114)
      • see remark 999 (173)
      • see remark 999 (204)
      • see remark 999 (206)
    Domains in SCOPe 2.08: d2rixa2, d2rixa3
  • Heterogens: MN, UDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rixA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrw
    qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssr
    eaftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwh
    deshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rixA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgamrrm
    emisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerr
    pqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnky
    llrhkptkvlspeylwdqqllgwpavlrklrftavp