PDB entry 2riu

View 2riu on RCSB PDB site
Description: Alternative models for two crystal structures of Candida albicans 3,4-dihydroxy-2-butanone 4-phosphate synthase- alternate interpreation
Class: isomerase
Keywords: alternate model, Magnesium, Manganese, Metal-binding, Riboflavin biosynthesis, ISOMERASE
Deposited on 2007-10-12, released 2008-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Candida albicans [TaxId:5476]
    Gene: RIB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2riua_
  • Heterogens: 5RP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2riuA (A:)
    mtniftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcv
    plseeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskp
    qdfikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrldd
    ciqfgkkhgikiininqlveyisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2riuA (A:)
    niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
    seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
    ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
    gikiininqlveyis