PDB entry 2ris

View 2ris on RCSB PDB site
Description: Crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase of candida albicans- alternate interpretation
Class: isomerase
Keywords: alternate model, Magnesium, Manganese, Metal-binding, Riboflavin biosynthesis, ISOMERASE
Deposited on 2007-10-12, released 2008-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Candida albicans [TaxId:5476]
    Gene: RIB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2risa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2risA (A:)
    mtniftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcv
    plseeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskp
    qdfikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrldd
    ciqfgkkhgikiininqlveyisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2risA (A:)
    niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
    seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
    ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
    gikiininqlveyisk