PDB entry 2riq

View 2riq on RCSB PDB site
Description: Crystal Structure of the Third Zinc-binding domain of human PARP-1
Deposited on 2007-10-12, released 2008-01-08
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EOH, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2riqA (A:)
mvdevakkkskkekdkdsklekalkaqndliwnikdelkkvcstndlkellifnkqqvps
gesaildrvadgmvfgallpceecsgqlvfksdayyctgdvtawtkcmvktqtpnrkewv
tpkefreisylkklkvkkqdrifppetsasvalehhhhhh

    Sequence, based on observed residues (ATOM records):
    >2riqA (A:)
kkekdkdsklekalkaqndliwnikdelkkvcstndlkellifnkqqvpsgesaildrva
dgmvfgallpceecsgqlvfksdayyctgdvtawtkcmvktqtpnrkewvtpkefreisy
lkklkvkkqdrifpp