PDB entry 2rip

View 2rip on RCSB PDB site
Description: Structure of DPPIV in complex with an inhibitor
Class: hydrolase
Keywords: DPPIV, DIABETES, DRUG DESIGN, Aminopeptidase, Glycoprotein, Hydrolase, Membrane, Protease, Secreted, Serine protease, Signal-anchor, Transmembrane
Deposited on 2007-10-12, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.218
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPPIV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ripa1, d2ripa2
  • Heterogens: NAG, 34Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ripA (A:)
    dsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfde
    fghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtw
    spvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwws
    pngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsls
    svtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrw
    nclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfi
    tkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyy
    svsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfi
    ilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivas
    fdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvts
    mvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkq
    veyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmsh
    fikqcfslp