PDB entry 2ril

View 2ril on RCSB PDB site
Description: crystal structure of a putative monooxygenase (yp_001095275.1) from shewanella loihica pv-4 at 1.26 a resolution
Deposited on 2007-10-11, released 2007-10-23
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibiotic biosynthesis monooxygenase
    Species: Shewanella loihica [TaxId:323850]
    Gene: YP_001095275.1, Shew_3150
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3QHR8 (1-98)
      • leader sequence (0)
  • Heterogens: CL, ACT, PGO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2rilA (A:)
gmsapvtlinpfkvpadkleaaieyweahrdfmaqqpgylstqlhqsidegatyqlinva
iwqseadfyqaaqkmrqalghvqveglcgnpalyrvirt

    Sequence, based on observed residues (ATOM records):
    >2rilA (A:)
gmsapvtlinpfkvpadkleaaieyweahrdfmaqqpgylstqlhqsidegatyqlinva
iwqseadfyqaaqkmrqalgeglcgnpalyrvirt