PDB entry 2ri6

View 2ri6 on RCSB PDB site
Description: Crystal Structure of S112A mutant of a C-C hydrolase, BphD from Burkholderia xenovorans LB400
Class: hydrolase
Keywords: HYDROLASE, C-C bond hydrolase, Aromatic hydrocarbons catabolism
Deposited on 2007-10-10, released 2007-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47229 (0-282)
      • engineered (108)
    Domains in SCOPe 2.08: d2ri6a1
  • Heterogens: NA, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ri6A (A:)
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnamggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcghwaqwehadefnrlvidflrha