PDB entry 2ri4

View 2ri4 on RCSB PDB site
Description: Crystal Structure determination of Goat Methemoglobin at 2.7 Angstrom
Class: Oxygen storage, Oxygen transport
Keywords: Methemoglobin, low oxygen affinity, Allosteric Mechanism, Heme, Iron, Metal-binding, Transport, Oxygen storage, Oxygen transport
Deposited on 2007-10-10, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4a_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-A
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4b_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4c_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-A
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4d_
  • Chain 'I':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4i_
  • Chain 'J':
    Compound: Hemoglobin subunit beta-A
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4j_
  • Chain 'K':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4k_
  • Chain 'L':
    Compound: Hemoglobin subunit beta-A
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ri4l_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ri4A (A:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
    vhasldkflanvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ri4A (A:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
    vhasldkflanvstvltsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ri4B (B:)
    mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
    ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
    ftpllqaefqkvvagvanalahryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ri4B (B:)
    ltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvka
    hgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgsef
    tpllqaefqkvvagvanalahr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ri4C (C:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
    vhasldkflanvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ri4C (C:)
    lsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghgek
    vaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpav
    hasldkflanvstvltsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ri4D (D:)
    mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
    ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
    ftpllqaefqkvvagvanalahryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ri4D (D:)
    mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
    ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
    ftpllqaefqkvvagvanalahry
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ri4I (I:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
    vhasldkflanvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ri4I (I:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhaklrvdpvnfkllshsllvtlachlpndftpav
    hasldkflanvstvlts
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ri4J (J:)
    mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
    ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
    ftpllqaefqkvvagvanalahryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ri4J (J:)
    ltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvka
    hgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgsef
    tpllqaefqkvvagvanalahryh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ri4K (K:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
    vhasldkflanvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ri4K (K:)
    lsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghgek
    vaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpav
    hasldkflanvstvltsk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ri4L (L:)
    mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
    ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
    ftpllqaefqkvvagvanalahryh