PDB entry 2rhs

View 2rhs on RCSB PDB site
Description: PheRS from Staphylococcus haemolyticus- rational protein engineering and inhibitor studies
Class: ligase
Keywords: heterotetramer, phenylalanine, tRNA, Aminoacyl-tRNA synthetase, ATP-binding, Cytoplasm, Ligase, Magnesium, Metal-binding, Nucleotide-binding, Protein biosynthesis, RNA-binding, tRNA-binding
Deposited on 2007-10-09, released 2007-11-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanyl-tRNA synthetase alpha chain
    Species: Staphylococcus haemolyticus [TaxId:1283]
    Gene: pheS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2rhsa_
  • Chain 'B':
    Compound: phenylalanyl-tRNA synthetase beta chain
    Species: Staphylococcus haemolyticus [TaxId:1283]
    Gene: pheT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4L5E4 (0-799)
      • engineered (33)
      • engineered (143)
      • engineered (660)
      • engineered (662-663)
  • Chain 'C':
    Compound: phenylalanyl-tRNA synthetase alpha chain
    Species: Staphylococcus haemolyticus [TaxId:1283]
    Gene: pheS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4L5E3 (26-293)
      • expression tag (23-25)
    Domains in SCOPe 2.04: d2rhsc_
  • Chain 'D':
    Compound: phenylalanyl-tRNA synthetase beta chain
    Species: Staphylococcus haemolyticus [TaxId:1283]
    Gene: pheT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4L5E4 (0-End)
      • engineered (33)
      • engineered (143)
      • engineered (660)
      • engineered (662-663)
  • Heterogens: SO4, ZN, GAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rhsA (A:)
    mgsshhhhhhssglvprgshmgtelmeklnqqlaeetidvtlpsrqisigskhpltrtve
    eiedlflglgyeivdgyeveqdyynfealnlpkshpardmqdsfyitdeilmrthtspvq
    artmekrngqgpvkiicpgkvyrrdsddathshqftqieglvvdknikmsdlkgtlelva
    kklfgadreirlrpsyfpftepsvevdvscfkckgkgcnvckhtgwieilgagmvhpnvl
    emagfdsneysgfafgmgpdriamlkygiediryfytndvrfleqfkavedrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhsA (A:)
    nqqlaeetidvtlpsrqisigskhpltrtveeiedlflglgyeivdgyeveqdyynfeal
    nlpkshpardmqdsfyitdeilmrthtspvqartmekrngqgpvkiicpgkvyrrdsdda
    thshqftqieglvvdknikmsdlkgtlelvakklfgadreirlrpsyfpftepsvevdvs
    wieilgagmvhpnvlemagfdsneysgfafgmgpdriamlkygiediryfytndvrfleq
    fkavedrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rhsC (C:)
    mgsshhhhhhssglvprgshmgtelmeklnqqlaeetidvtlpsrqisigskhpltrtve
    eiedlflglgyeivdgyeveqdyynfealnlpkshpardmqdsfyitdeilmrthtspvq
    artmekrngqgpvkiicpgkvyrrdsddathshqftqieglvvdknikmsdlkgtlelva
    kklfgadreirlrpsyfpftepsvevdvscfkckgkgcnvckhtgwieilgagmvhpnvl
    emagfdsneysgfafgmgpdriamlkygiediryfytndvrfleqfkavedrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhsC (C:)
    elmeklnqqlaeetidvtlpsrqisigskhpltrtveeiedlflglgyeivdgyeveqdy
    ynfealnlpkshpardmqdsfyitdeilmrthtspvqartmekrngqgpvkiicpgkvyr
    rdsddathshqftqieglvvdknikmsdlkgtlelvakklfgadreirlrpsyfpfteps
    vevdvscfkckgkgcnvckhtgwieilgagmvhpnvlemagfdsneysgfafgmgpdria
    mlkygiediryfytndvrfleqfkavedrge
    

  • Chain 'D':
    No sequence available.