PDB entry 2rhr

View 2rhr on RCSB PDB site
Description: P94L actinorhodin ketordeuctase mutant, with NADPH and Inhibitor Emodin
Class: oxidoreductase
Keywords: oxidoreductase, polyketide, actinorhodin, ketoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase
Deposited on 2007-10-09, released 2008-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actinorhodin Polyketide Ketoreductase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: actIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16544 (Start-276)
      • engineered (109)
    Domains in SCOPe 2.07: d2rhra_
  • Chain 'B':
    Compound: Actinorhodin Polyketide Ketoreductase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: actIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16544 (16-276)
      • expression tag (13-15)
      • engineered (109)
    Domains in SCOPe 2.07: d2rhrb1, d2rhrb2
  • Heterogens: NDP, EMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rhrA (A:)
    hhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglr
    ttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataelad
    elwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgv
    vgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpig
    ryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhrA (A:)
    sevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdvr
    svpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltgvfrvtkqv
    lkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvnav
    cpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpgaa
    avtaqalnvcgglgny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rhrB (B:)
    hhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglr
    ttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataelad
    elwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgv
    vgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpig
    ryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhrB (B:)
    gshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagvea
    dgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltg
    vfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelar
    tgitvnavcpgfvetpmaasvrehteeafdritarvpigryvqpsevaemvayligpgaa
    avtaqalnvcgglgny