PDB entry 2rhq

View 2rhq on RCSB PDB site
Description: PheRS from Staphylococcus haemolyticus- rational protein engineering and inhibitor studies
Class: ligase
Keywords: heterotetramer, phenylalanine, tRNA, Aminoacyl-tRNA synthetase, ATP-binding, Cytoplasm, Ligase, Magnesium, Metal-binding, Nucleotide-binding, Protein biosynthesis, RNA-binding, tRNA-binding
Deposited on 2007-10-09, released 2007-11-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanyl-tRNA synthetase alpha chain
    Species: Staphylococcus haemolyticus [TaxId:1283]
    Gene: pheS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4L5E3 (26-293)
      • expression tag (24-25)
    Domains in SCOPe 2.04: d2rhqa_
  • Chain 'B':
    Compound: phenylalanyl-tRNA synthetase beta chain
    Species: Staphylococcus haemolyticus [TaxId:1283]
    Gene: pheT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4L5E4 (0-794)
      • engineered (33)
      • engineered (55-57)
      • engineered (139)
      • engineered (790)
  • Heterogens: ZN, GAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rhqA (A:)
    mgsshhhhhhssglvprgshmgtelmeklnqqlaeetidvtlpsrqisigskhpltrtve
    eiedlflglgyeivdgyeveqdyynfealnlpkshpardmqdsfyitdeilmrthtspvq
    artmekrngqgpvkiicpgkvyrrdsddathshqftqieglvvdknikmsdlkgtlelva
    kklfgadreirlrpsyfpftepsvevdvscfkckgkgcnvckhtgwieilgagmvhpnvl
    emagfdsneysgfafgmgpdriamlkygiediryfytndvrfleqfkavedrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhqA (A:)
    lmeklnqqlaeetidvtlpsrqisigskhpltrtveeiedlflglgyeivdgyeveqdyy
    nfealnlpkshpardmqdsfyitdeilmrthtspvqartmekrngqgpvkiicpgkvyrr
    dsddathshqftqieglvvdknikmsdlkgtlelvakklfgadreirlrpsyfpftepsv
    evdvscfkckgkgcnvckhtgwieilgagmvhpnvlemagfdsneysgfafgmgpdriam
    lkygiediryfytndvrfleqfkavedrge
    

  • Chain 'B':
    No sequence available.