PDB entry 2rho

View 2rho on RCSB PDB site
Description: Synthetic Gene Encoded Bacillus Subtilis FtsZ NCS Dimer with Bound GDP and GTP-gamma-S
Class: cell cycle
Keywords: CELL DIVISION PROTEIN, TUBULIN HOMOLOG, GTP-BINDING, POLYMERIZATION, GTPASE, CELL CYCLE, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D
Deposited on 2007-10-09, released 2008-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17865 (1-304)
      • expression tag (305)
    Domains in SCOPe 2.06: d2rhoa1, d2rhoa2, d2rhoa3
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2rhob1, d2rhob2
  • Heterogens: GSP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rhoA (A:)
    masikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglg
    aganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvg
    vvtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvl
    rqgvqgisdliatpglinldfadvktimsnkgsalmgigiatgenraaeaakkaisspll
    eaaidgaqgvlmnitggtnlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtv
    iatgflenlyfqghhhhhheympme
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhoA (A:)
    asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga
    ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv
    vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr
    qgvqgisdliatpglinldfadvktimsnkgsalmgigiatgenraaeaakkaissplle
    aaidgaqgvlmnitggtnlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtvi
    atgfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rhoB (B:)
    masikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglg
    aganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvg
    vvtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvl
    rqgvqgisdliatpglinldfadvktimsnkgsalmgigiatgenraaeaakkaisspll
    eaaidgaqgvlmnitggtnlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtv
    iatgflenlyfqghhhhhheympme
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhoB (B:)
    asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga
    ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv
    vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr
    qgvqgisdliatpglinldfadvktimsnsalmgigiatgenraaeaakkaissplleaa
    idgaqgvlmnitggtnlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviat
    gf