PDB entry 2rhe

View 2rhe on RCSB PDB site
Description: structure of a novel bence-jones protein (rhe) fragment at 1.6 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1983-06-13, released 1983-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.149
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bence-jones protein rhe (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S25752 (1-113)
      • conflict (22)
      • conflict (25-27)
      • conflict (32)
      • conflict (34)
      • conflict (39)
      • conflict (42)
      • conflict (50)
      • conflict (52-54)
      • conflict (59)
      • conflict (64)
      • conflict (79)
      • conflict (92)
      • conflict (96-99)
    Domains in SCOPe 2.04: d2rhea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rheA (A:)
    esvltqppsasgtpgqrvtisctgsatdigsnsviwyqqvpgkapklliyyndllpsgvs
    drfsasksgtsaslaisglesedeadyycaawndsldepgfgggtkltvlgqpk