PDB entry 2rhb

View 2rhb on RCSB PDB site
Description: Crystal structure of Nsp15-H234A mutant- Hexamer in asymmetric unit
Class: viral protein
Keywords: endoribonuclease, sars, hexamer, RNA, nsp, viral protein
Deposited on 2007-10-08, released 2007-11-27
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-13, with a file datestamp of 2008-05-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridylate-specific endoribonuclease
    Species: SARS coronavirus
    Gene: Nsp15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (7-End)
      • expression tag (6)
      • engineered (240)
    Domains in SCOP 1.75: d2rhba1, d2rhba2
  • Chain 'B':
    Compound: Uridylate-specific endoribonuclease
    Species: SARS coronavirus
    Gene: Nsp15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (7-End)
      • expression tag (5-6)
      • engineered (240)
    Domains in SCOP 1.75: d2rhbb1, d2rhbb2
  • Chain 'C':
    Compound: Uridylate-specific endoribonuclease
    Species: SARS coronavirus
    Gene: Nsp15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (7-End)
      • expression tag (6)
      • engineered (240)
    Domains in SCOP 1.75: d2rhbc1, d2rhbc2
  • Chain 'D':
    Compound: Uridylate-specific endoribonuclease
    Species: SARS coronavirus
    Gene: Nsp15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (7-End)
      • expression tag (5-6)
      • engineered (240)
    Domains in SCOP 1.75: d2rhbd1, d2rhbd2
  • Chain 'E':
    Compound: Uridylate-specific endoribonuclease
    Species: SARS coronavirus
    Gene: Nsp15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (7-End)
      • expression tag (5-6)
      • engineered (240)
    Domains in SCOP 1.75: d2rhbe1, d2rhbe2
  • Chain 'F':
    Compound: Uridylate-specific endoribonuclease
    Species: SARS coronavirus
    Gene: Nsp15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (7-End)
      • engineered (240)
    Domains in SCOP 1.75: d2rhbf1, d2rhbf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rhbA (A:)
    hhhhhhmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnv
    afelwakrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkpte
    sacssltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvk
    tqfnyfkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafe
    aivygdfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcs
    vidlllddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhbA (A:)
    mslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelwa
    krnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacssl
    tvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfnyf
    kkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivygd
    fshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlll
    ddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rhbB (B:)
    hhhhhhmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnv
    afelwakrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkpte
    sacssltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvk
    tqfnyfkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafe
    aivygdfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcs
    vidlllddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhbB (B:)
    hmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelw
    akrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacss
    ltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfny
    fkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivyg
    dfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidll
    lddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rhbC (C:)
    hhhhhhmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnv
    afelwakrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkpte
    sacssltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvk
    tqfnyfkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafe
    aivygdfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcs
    vidlllddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhbC (C:)
    mslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelwa
    krnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacssl
    tvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfnyf
    kkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivygd
    fshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlll
    ddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rhbD (D:)
    hhhhhhmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnv
    afelwakrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkpte
    sacssltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvk
    tqfnyfkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafe
    aivygdfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcs
    vidlllddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhbD (D:)
    hmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelw
    akrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacss
    ltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfny
    fkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivyg
    dfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidll
    lddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2rhbE (E:)
    hhhhhhmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnv
    afelwakrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkpte
    sacssltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvk
    tqfnyfkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafe
    aivygdfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcs
    vidlllddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhbE (E:)
    hmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelw
    akrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacss
    ltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfny
    fkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivyg
    dfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidll
    lddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2rhbF (F:)
    hhhhhhmslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnv
    afelwakrnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkpte
    sacssltvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvk
    tqfnyfkkvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafe
    aivygdfshgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcs
    vidlllddfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rhbF (F:)
    slenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelwak
    rnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacsslt
    vlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfnyfk
    kvdgiiqqlpetyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivygdf
    shgqlgglhlmiglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidllld
    dfveiiksqdlsviskvvkvtidyaeisfmlwckdghvetfypk