PDB entry 2rh3

View 2rh3 on RCSB PDB site
Description: Crystal structure of plasmid pTiC58 VirC2
Class: DNA binding protein
Keywords: Ribbon-Helix-Helix, Protein, Crown gall tumor, DNA binding protein
Deposited on 2007-10-05, released 2008-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein virC2
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: virC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2rh3a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rh3A (A:)
    iqvflsarppapevskiydnlilqyspskslqmilrralgdfenmladgsfraapksypi
    phtafeksiivqtsrmfpvslieaarnhfdplgletarafghklataalacffarekatn
    s