PDB entry 2rh3

View 2rh3 on RCSB PDB site
Description: Crystal structure of plasmid pTiC58 VirC2
Class: DNA binding protein
Keywords: Ribbon-Helix-Helix, Protein, Crown gall tumor, DNA binding protein
Deposited on 2007-10-05, released 2008-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein virC2
  Species: Agrobacterium tumefaciens [TaxId:358]
  Gene: virC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07166 (0-120)
  Domains in SCOPe 2.08: d2rh3a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rh3A (A:)
  iqvflsarppapevskiydnlilqyspskslqmilrralgdfenmladgsfraapksypi
  phtafeksiivqtsrmfpvslieaarnhfdplgletarafghklataalacffarekatn
  s