PDB entry 2rh2

View 2rh2 on RCSB PDB site
Description: High Resolution DHFR R-67
Class: oxidoreductase
Keywords: FOLATE METABOLISM, PLASMID-ENCODED R67 DHFR, TMP-RESISTANT DHFR, Antibiotic resistance, Methotrexate resistance, NADP, One-carbon metabolism, Oxidoreductase, Trimethoprim resistance
Deposited on 2007-10-05, released 2008-06-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.104
AEROSPACI score: 1.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrofolate reductase type 2
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2rh2a_
  • Heterogens: MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rh2A (A:)
    vfpsnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
    in
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rh2A (A:)
    natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin