PDB entry 2rgp

View 2rgp on RCSB PDB site
Description: Structure of EGFR in complex with hydrazone, a potent dual inhibitor
Class: transferase
Keywords: Kinase domain, Alternative splicing, Anti-oncogene, ATP-binding, Cell cycle, Disease mutation, Glycoprotein, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase, Ubl conjugation
Deposited on 2007-10-04, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rgpa_
  • Heterogens: PO4, HYZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rgpA (A:)
    allrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeild
    eayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqi
    akgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwm
    alesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppicti
    dvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyral
    mdeedmddvvdadey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgpA (A:)
    allrilketefkkikvlgsgafgtvykglwipvkipvaikelrkankeildeayvmasvd
    nphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyled
    rrlvhrdlaarnvlvktpqhvkitdfglakllgaeekvpikwmalesilhriythqsdvw
    sygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsr
    pkfreliiefskmardpqrylviqgdermnfyralmdvvdadey