PDB entry 2rgi

View 2rgi on RCSB PDB site
Description: Crystal structure of Ca2+-free S100A2 at 1.6 A resolution
Class: metal binding protein
Keywords: alpha helical, EF-hand, METAL BINDING PROTEIN
Deposited on 2007-10-03, released 2008-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A2, S100L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29034
      • engineered (2)
      • engineered (21)
      • engineered (86)
      • engineered (93)
    Domains in SCOPe 2.06: d2rgia_
  • Chain 'B':
    Compound: Protein S100-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A2, S100L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29034
      • engineered (2)
      • engineered (21)
      • engineered (86)
      • engineered (93)
    Domains in SCOPe 2.06: d2rgib_
  • Heterogens: NA, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rgiA (A:)
    mmsssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklm
    gsldensdqqvdfqeyavflalitvmsndffqgspdrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgiA (A:)
    msssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklmg
    sldensdqqvdfqeyavflalitvmsndffqgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rgiB (B:)
    mmsssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklm
    gsldensdqqvdfqeyavflalitvmsndffqgspdrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rgiB (B:)
    sssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklmgs
    ldensdqqvdfqeyavflalitvmsndffqgs