PDB entry 2rgg

View 2rgg on RCSB PDB site
Description: Crystal structure of H-RasQ61I-GppNHp, trigonal crystal form
Class: oncoprotein
Keywords: MOLECULAR SWITCH PROTEIN, SIGNALING PROTEIN, GTPASE, Disease mutation, Golgi apparatus, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Palmitate, Prenylation, Proto-oncogene, ONCOPROTEIN
Deposited on 2007-10-03, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.215
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rgga_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rggA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    ieeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rggA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    rdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartves
    rqaqdlarsygipyietsaktrqgvedafytlvreirqh