PDB entry 2rgf

View 2rgf on RCSB PDB site
Description: rbd of ral guanosine-nucleotide exchange factor (protein), nmr, 10 structures
Class: ras-binding domain
Keywords: ras-binding domain, ralgef, ralgds, ras, rbd
Deposited on 1997-02-13, released 1998-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ralgef-rbd
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN RALGEF GENE (RALGDS)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rgfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rgfA (A:)
    alplynqqvgdcciirvsldvdngnmyksilvtsqdkapavirkamdkhnleeeepedye
    llqilsddrklkipenanvfyamnstanydfvlkkrt