PDB entry 2rg9

View 2rg9 on RCSB PDB site
Description: Crystal structure of viscum album mistletoe lectin I in native state at 1.95 A resolution, comparison of structure active site conformation in ricin and in viscumin
Class: hydrolase, toxin
Keywords: RIBOSOME-INACTIVATING PROTEIN TYPE II, Glycoprotein, Hydrolase, Lectin, Plant defense, Protein synthesis inhibitor, Toxin
Deposited on 2007-10-03, released 2008-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-galactoside-specific lectin 1 chain A isoform 1
  Species: Viscum album
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81446 (0-248)
    • conflict (4)
    • conflict (7-9)
    • conflict (18)
    • conflict (26)
    • conflict (35)
    • conflict (48)
    • conflict (50)
    • conflict (83)
    • conflict (89)
    • conflict (98-99)
    • conflict (207)
    • conflict (221)
    • conflict (226)
    • conflict (232)
  Domains in SCOPe 2.08: d2rg9a_
• Chain 'B':
  Compound: Beta-galactoside-specific lectin 1 chain B
  Species: Viscum album
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81446 (0-262)
    • conflict (10)
    • conflict (20)
    • conflict (29)
    • conflict (53)
    • conflict (89)
    • conflict (91)
    • conflict (165)
    • conflict (167)
    • conflict (169)
    • conflict (188)
    • conflict (193)
    • conflict (253)
  Domains in SCOPe 2.08: d2rg9b1, d2rg9b2
• Heterogens: NAG, SO4, AZI, CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rg9A (A:)
  yerlslrtvqqttgeeyfsfitllrdfvssgsfsnnipllrqstipvseasrfvlveltn
  eggdsitaaidvtnlyvvayqagqqsyflkdaprgaetqdftgttrsslpfngsypdler
  yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
  nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlalppgnvvtltnirdviasl
  aimlfvcge
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rg9B (B:)
  ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
  ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
  vqtldytlgqgwlagndtaprevtiygfrdlcmesnggsvwvetctigqenqrwalygdg
  sirpkqnqsqcltngrdsvstvinivscsagssgqrwvftnegailnlknglamdvaqan
  pklrriiiypatgnpnqmwlpvp