PDB entry 2rg7

View 2rg7 on RCSB PDB site
Description: Apo- Crystal Structure of a Periplasmic Heme Binding Protein from Shigella dysenteriae
Class: transport protein
Keywords: periplasmic heme binding protein, transport protein
Deposited on 2007-10-02, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.232
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic HEME binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rg7a_
  • Chain 'B':
    Compound: Periplasmic HEME binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rg7b_
  • Chain 'C':
    Compound: Periplasmic HEME binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rg7c_
  • Chain 'D':
    Compound: Periplasmic HEME binding protein
    Species: Shigella dysenteriae [TaxId:622]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rg7d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rg7A (A:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rg7A (A:)
    aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
    svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
    inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
    sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
    iadvveslhqqlwpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rg7B (B:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rg7B (B:)
    aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
    svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
    inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
    sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
    iadvveslhqqlwpq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2rg7C (C:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rg7C (C:)
    aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
    svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
    inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
    sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
    iadvveslhqqlwpq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2rg7D (D:)
    aaerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrp
    dsvitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvt
    qinqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqy
    ksysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgp
    riadvveslhqqlwpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rg7D (D:)
    aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
    svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
    inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
    sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
    iadvveslhqqlwpq