PDB entry 2rg1

View 2rg1 on RCSB PDB site
Description: Crystal structure of E. coli WrbA apoprotein
Class: oxidoreductase, electron transport
Keywords: electron transport, quinone oxidoreductase, flavoprotein, flavodoxin-like fold, FMN-binding, OXIDOREDUCTASE
Deposited on 2007-10-02, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavoprotein WrbA
    Species: Escherichia coli [TaxId:562]
    Gene: wrba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rg1a_
  • Chain 'B':
    Compound: Flavoprotein WrbA
    Species: Escherichia coli [TaxId:562]
    Gene: wrba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2rg1b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2rg1A (A:)
    makvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapv
    atpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggq
    eqtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeels
    iaryqgeyvaglavklng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rg1A (A:)
    akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetgktqtapvatpqeladyda
    iifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgggqeqtitstwttlah
    hgmvivpigyagtpygattiasrqpsqeelsiaryqgeyvaglavkln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2rg1B (B:)
    makvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapv
    atpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggq
    eqtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeels
    iaryqgeyvaglavklng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2rg1B (B:)
    akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetqtapvatpqeladydaiif
    gtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqeqtitstwttlahh
    gmvivpigyagtpygattiaqpsqeelsiaryqgeyvaglavklng