PDB entry 2rg0

View 2rg0 on RCSB PDB site
Description: Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotetraose
Class: hydrolase
Keywords: hydrolase, Glycosidase
Deposited on 2007-10-02, released 2008-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rg0a_
  • Chain 'B':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rg0b_
  • Chain 'C':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rg0c_
  • Chain 'D':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rg0d_
  • Heterogens: CBI, CTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rg0A (A:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rg0B (B:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rg0C (C:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rg0D (D:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf