PDB entry 2rfw

View 2rfw on RCSB PDB site
Description: Crystal Structure of Cellobiohydrolase from Melanocarpus albomyces
Class: hydrolase
Keywords: hydrolase, Glycosidase
Deposited on 2007-10-02, released 2008-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rfwa_
  • Chain 'B':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rfwb_
  • Chain 'C':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rfwc_
  • Chain 'D':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Melanocarpus albomyces [TaxId:204285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J0K6 (0-429)
      • engineered (0)
    Domains in SCOPe 2.05: d2rfwd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfwA (A:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfwB (B:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfwC (C:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rfwD (D:)
    eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
    tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
    nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
    kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
    tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
    fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
    lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
    fgpigstydf